SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ey3a2 (5ey3 A:71-335)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106674Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2106675Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2106676Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 protein domains)
  6. 2106735Protein automated matches [254642] (3 species)
    not a true protein
  7. 2106743Species Salmonella typhimurium [TaxId:99287] [311466] (3 PDB entries)
  8. 2283577Domain d5ey3a2: 5ey3 A:71-335 [326878]
    Other proteins in same PDB: d5ey3a1, d5ey3a3, d5ey3a4, d5ey3b1, d5ey3b3
    automated match to d4x46b2
    complexed with ctn, edo, gol, so4

Details for d5ey3a2

PDB Entry: 5ey3 (more details), 1.91 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d5ey3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ey3a2 c.27.1.1 (A:71-335) automated matches {Salmonella typhimurium [TaxId: 99287]}
dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai
pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa
evfgrmvaaqkgpsdfvenydkylp

SCOPe Domain Coordinates for d5ey3a2:

Click to download the PDB-style file with coordinates for d5ey3a2.
(The format of our PDB-style files is described here.)

Timeline for d5ey3a2:

  • d5ey3a2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08