SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ey3a1 (5ey3 A:1-70)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997771Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 1997782Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 1997842Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 1997843Protein automated matches [254641] (5 species)
    not a true protein
  7. 1997851Species Salmonella typhimurium [TaxId:99287] [311465] (3 PDB entries)
  8. 2283576Domain d5ey3a1: 5ey3 A:1-70 [326877]
    Other proteins in same PDB: d5ey3a2, d5ey3a3, d5ey3a4, d5ey3b2, d5ey3b3
    automated match to d4x46b1
    complexed with ctn, edo, gol, so4

Details for d5ey3a1

PDB Entry: 5ey3 (more details), 1.91 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d5ey3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ey3a1 a.46.2.0 (A:1-70) automated matches {Salmonella typhimurium [TaxId: 99287]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

SCOPe Domain Coordinates for d5ey3a1:

Click to download the PDB-style file with coordinates for d5ey3a1.
(The format of our PDB-style files is described here.)

Timeline for d5ey3a1:

  • d5ey3a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-07