![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (71 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries) |
![]() | Domain d5f6fb1: 5f6f B:2-139 [326875] Other proteins in same PDB: d5f6fa2, d5f6fb2 automated match to d4llla_ mutant |
PDB Entry: 5f6f (more details), 1.75 Å
SCOPe Domain Sequences for d5f6fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f6fb1 a.4.5.0 (B:2-139) automated matches {Staphylococcus aureus [TaxId: 1280]} eftysylfrmishemkqkadqkleqfditneqrhtlgylyahqqdgltqndiakalqrtg ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse eeneqmkanltkmlsslq
Timeline for d5f6fb1: