Lineage for d5daka1 (5dak A:77-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996931Protein Class pi GST [81347] (4 species)
  7. 1996932Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries)
  8. 2283553Domain d5daka1: 5dak A:77-209 [326854]
    automated match to d13gsa1
    complexed with ars, mes

Details for d5daka1

PDB Entry: 5dak (more details), 2.11 Å

PDB Description: crystal structure of human glutathione transferase pi complexed with a metalloid in the absence of glutathione
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5daka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5daka1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d5daka1:

Click to download the PDB-style file with coordinates for d5daka1.
(The format of our PDB-style files is described here.)

Timeline for d5daka1:

  • d5daka1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-07