Lineage for d5dalb2 (5dal B:77-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996931Protein Class pi GST [81347] (4 species)
  7. 1996932Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries)
  8. 2283549Domain d5dalb2: 5dal B:77-209 [326850]
    Other proteins in same PDB: d5dala1, d5dalb1
    automated match to d13gsa1
    complexed with 5au, gsh, mes, pa0, so4

Details for d5dalb2

PDB Entry: 5dal (more details), 1.5 Å

PDB Description: crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d5dalb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dalb2 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d5dalb2:

Click to download the PDB-style file with coordinates for d5dalb2.
(The format of our PDB-style files is described here.)

Timeline for d5dalb2:

  • d5dalb2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-07

View in 3D
Domains from same chain:
(mouse over for more information)
d5dalb1