SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5e11a1 (5e11 A:336-428)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048811Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2048812Protein automated matches [190436] (8 species)
    not a true protein
  7. 2048826Species Human (Homo sapiens) [TaxId:9606] [187333] (91 PDB entries)
  8. 2283547Domain d5e11a1: 5e11 A:336-428 [326848]
    Other proteins in same PDB: d5e11a2
    automated match to d2vwra_

Details for d5e11a1

PDB Entry: 5e11 (more details), 1.8 Å

PDB Description: second pdz domain of ligand of numb protein x 2 by laue crystallography (no electric field)
PDB Compounds: (A:) ligand of numb protein x 2

SCOPe Domain Sequences for d5e11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e11a1 b.36.1.0 (A:336-428) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eilqvalhkrdsgeqlgiklvrrtdepgvfildllegglaaqdgrlssndrvlainghdl
kygtpelaaqiiqasgervnltiarpgkpeiel

SCOPe Domain Coordinates for d5e11a1:

Click to download the PDB-style file with coordinates for d5e11a1.
(The format of our PDB-style files is described here.)

Timeline for d5e11a1:

  • d5e11a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-07

View in 3D
Domains from same chain:
(mouse over for more information)
d5e11a2