Lineage for d5e11a1 (5e11 A:336-428)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048811Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2048812Protein automated matches [190436] (8 species)
    not a true protein
  7. 2048826Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)
  8. 2283547Domain d5e11a1: 5e11 A:336-428 [326848]
    Other proteins in same PDB: d5e11a2
    automated match to d2vwra_

Details for d5e11a1

PDB Entry: 5e11 (more details), 1.8 Å

PDB Description: second pdz domain of ligand of numb protein x 2 by laue crystallography (no electric field)
PDB Compounds: (A:) ligand of numb protein x 2

SCOPe Domain Sequences for d5e11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e11a1 b.36.1.0 (A:336-428) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eilqvalhkrdsgeqlgiklvrrtdepgvfildllegglaaqdgrlssndrvlainghdl
kygtpelaaqiiqasgervnltiarpgkpeiel

SCOPe Domain Coordinates for d5e11a1:

Click to download the PDB-style file with coordinates for d5e11a1.
(The format of our PDB-style files is described here.)

Timeline for d5e11a1:

  • d5e11a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-07

View in 3D
Domains from same chain:
(mouse over for more information)
d5e11a2