SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b1hb_ (5b1h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (28 species)
    not a true protein
  7. 2283544Species Lactobacillus plantarum [TaxId:220668] [326845] (1 PDB entry)
  8. 2283545Domain d5b1hb_: 5b1h B: [326846]
    automated match to d4lmaa_
    complexed with gol, so4

Details for d5b1hb_

PDB Entry: 5b1h (more details), 2.4 Å

PDB Description: crystal structure of cystathionine beta-synthase from lactobacillus plantarum
PDB Compounds: (B:) cystathionine beta-synthase

SCOPe Domain Sequences for d5b1hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1hb_ c.79.1.0 (B:) automated matches {Lactobacillus plantarum [TaxId: 220668]}
mliqhvqelightplmalpievpnhshiyaklemfnpggsikdrlgayliedglqrgrvn
akttiieptagntgiglalatqahhlrtilvvpekfsmekqvlmqalgaeivhtpseegi
kgairkaealaatisnsyvpmqfknpanpaayyhtlapeiladmpapitafvagagsggt
fagvaaylqaqdsatkavvvepegsilnggpahahrtegigvefippffdqvridqtlti
adndafaqvrhlardhglligsssgaalaaslqlatnlpanshivtifpdsserylsqki
ytk

SCOPe Domain Coordinates for d5b1hb_:

Click to download the PDB-style file with coordinates for d5b1hb_.
(The format of our PDB-style files is described here.)

Timeline for d5b1hb_:

  • d5b1hb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-07