Lineage for d5boza_ (5boz A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207715Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2207716Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2207717Family d.165.1.1: Plant cytotoxins [56372] (18 protein domains)
  6. 2207818Protein Ricin A-chain [56389] (1 species)
  7. 2207819Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (47 PDB entries)
    Uniprot P06750 28-286
  8. 2283543Domain d5boza_: 5boz A: [326844]
    Other proteins in same PDB: d5bozg_, d5bozh_, d5bozi_, d5bozj_, d5bozk_, d5bozl_
    automated match to d4lgsa_
    complexed with cl, so4

Details for d5boza_

PDB Entry: 5boz (more details), 3.1 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh9)(e1)
PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d5boza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5boza_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcappp

SCOPe Domain Coordinates for d5boza_:

Click to download the PDB-style file with coordinates for d5boza_.
(The format of our PDB-style files is described here.)

Timeline for d5boza_:

  • d5boza_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-07