SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5boze_ (5boz E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207715Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2207716Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2207717Family d.165.1.1: Plant cytotoxins [56372] (18 protein domains)
  6. 2207818Protein Ricin A-chain [56389] (1 species)
  7. 2207819Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (47 PDB entries)
    Uniprot P06750 28-286
  8. 2283542Domain d5boze_: 5boz E: [326843]
    Other proteins in same PDB: d5bozg_, d5bozh_, d5bozi_, d5bozj_, d5bozk_, d5bozl_
    automated match to d4lgsa_
    complexed with cl, so4

Details for d5boze_

PDB Entry: 5boz (more details), 3.1 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh9)(e1)
PDB Compounds: (E:) ricin

SCOPe Domain Sequences for d5boze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5boze_ d.165.1.1 (E:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcappp

SCOPe Domain Coordinates for d5boze_:

Click to download the PDB-style file with coordinates for d5boze_.
(The format of our PDB-style files is described here.)

Timeline for d5boze_:

  • d5boze_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-07