Lineage for d5tpab_ (5tpa B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144965Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)
  7. 2271414Species Homo sapiens [TaxId:9606] [314718] (12 PDB entries)
  8. 2283539Domain d5tpab_: 5tpa B: [326840]
    Other proteins in same PDB: d5tpaa_
    automated match to d5i2kb_
    complexed with 7h2, glu, gly

Details for d5tpab_

PDB Entry: 5tpa (more details), 2.48 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with compound 9 (gne3500)
PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5tpab_:

Sequence, based on SEQRES records: (download)

>d5tpab_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi
vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv
diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt
gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqec

Sequence, based on observed residues (ATOM records): (download)

>d5tpab_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftdpvkkvictgpndtspgsprhtvpqccy
gfcidlliklartmnftyevhlvadgkfgtqervkkewngmmgellsgqadmivapltin
neraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrq
velstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrs
gfgigmrkdspwkqnvslsilkshengfmedldktwvrc

SCOPe Domain Coordinates for d5tpab_:

Click to download the PDB-style file with coordinates for d5tpab_.
(The format of our PDB-style files is described here.)

Timeline for d5tpab_:

  • d5tpab_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01