SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpab_ (5tpa B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144965Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)
  7. 2271414Species Homo sapiens [TaxId:9606] [314718] (12 PDB entries)
  8. 2283539Domain d5tpab_: 5tpa B: [326840]
    Other proteins in same PDB: d5tpaa_
    automated match to d5i2kb_
    complexed with 7h2, glu, gly

Details for d5tpab_

PDB Entry: 5tpa (more details), 2.48 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with compound 9 (gne3500)
PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5tpab_:

Sequence, based on SEQRES records: (download)

>d5tpab_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi
vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv
diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt
gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqec

Sequence, based on observed residues (ATOM records): (download)

>d5tpab_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftdpvkkvictgpndtspgsprhtvpqccy
gfcidlliklartmnftyevhlvadgkfgtqervkkewngmmgellsgqadmivapltin
neraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrq
velstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrs
gfgigmrkdspwkqnvslsilkshengfmedldktwvrc

SCOPe Domain Coordinates for d5tpab_:

Click to download the PDB-style file with coordinates for d5tpab_.
(The format of our PDB-style files is described here.)

Timeline for d5tpab_:

  • d5tpab_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01