Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (21 PDB entries) |
Domain d5k9qn_: 5k9q N: [326836] Other proteins in same PDB: d5k9qa_, d5k9qc_, d5k9qe_, d5k9qg_, d5k9qh_, d5k9qi1, d5k9qi2, d5k9qj_, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qm_, d5k9qo_, d5k9qq_, d5k9qs_, d5k9qt1, d5k9qt2, d5k9qu_, d5k9qv1, d5k9qv2, d5k9qx_, d5k9qy1, d5k9qy2 automated match to d3vunb_ complexed with nag |
PDB Entry: 5k9q (more details), 2.5 Å
SCOPe Domain Sequences for d5k9qn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k9qn_ h.3.1.1 (N:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
Timeline for d5k9qn_:
View in 3D Domains from other chains: (mouse over for more information) d5k9qa_, d5k9qb_, d5k9qc_, d5k9qd_, d5k9qe_, d5k9qf_, d5k9qg_, d5k9qh_, d5k9qi1, d5k9qi2, d5k9qj_, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qm_, d5k9qo_, d5k9qp_, d5k9qq_, d5k9qr_, d5k9qs_, d5k9qt1, d5k9qt2, d5k9qu_, d5k9qv1, d5k9qv2, d5k9qx_, d5k9qy1, d5k9qy2 |