SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t3ha_ (5t3h A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2056847Species Cow (Bos taurus) [TaxId:9913] [50516] (403 PDB entries)
    Uniprot P00760
  8. 2283532Domain d5t3ha_: 5t3h A: [326833]
    automated match to d1j8aa_
    complexed with ben, ca, gol, sey, so4

Details for d5t3ha_

PDB Entry: 5t3h (more details), 1.55 Å

PDB Description: bovine trypsin soaked with selenourea for 5 min
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d5t3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t3ha_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d5t3ha_:

Click to download the PDB-style file with coordinates for d5t3ha_.
(The format of our PDB-style files is described here.)

Timeline for d5t3ha_:

  • d5t3ha_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01