Lineage for d5tvcc1 (5tvc C:1-207)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2074176Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2074177Protein automated matches [193506] (6 species)
    not a true protein
  7. 2074530Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)
  8. 2283527Domain d5tvcc1: 5tvc C:1-207 [326828]
    Other proteins in same PDB: d5tvca2, d5tvcc2, d5tvce2
    automated match to d2w8gc_
    complexed with 1pe, 7lb, so4

Details for d5tvcc1

PDB Entry: 5tvc (more details), 1.93 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with (e,2s)-n-methyl-5- (5-phenoxy-3-pyridyl)pent-4-en-2-amine (ti-5312)
PDB Compounds: (C:) Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d5tvcc1:

Sequence, based on SEQRES records: (download)

>d5tvcc1 b.96.1.0 (C:1-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qykhdikyncceeiypdvvlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d5tvcc1 b.96.1.0 (C:1-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnsl
mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhd
ieeiypdvvlvvkfrer

SCOPe Domain Coordinates for d5tvcc1:

Click to download the PDB-style file with coordinates for d5tvcc1.
(The format of our PDB-style files is described here.)

Timeline for d5tvcc1:

  • d5tvcc1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-01