Lineage for d5ctpa_ (5ctp A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2197713Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2197714Species Human (Homo sapiens) [TaxId:9606] [75559] (88 PDB entries)
  8. 2283526Domain d5ctpa_: 5ctp A: [326827]
    automated match to d3wara_
    complexed with 54r, act, po4

Details for d5ctpa_

PDB Entry: 5ctp (more details), 2.03 Å

PDB Description: crystal structure of ck2alpha with n-(3-(3-chloro-4-(phenyl) benzylamino)propyl)acetamide bound
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5ctpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ctpa_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
pvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnne
kvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
llrydhqsrltareamehpyfytv

SCOPe Domain Coordinates for d5ctpa_:

Click to download the PDB-style file with coordinates for d5ctpa_.
(The format of our PDB-style files is described here.)

Timeline for d5ctpa_:

  • d5ctpa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01