Lineage for d5tvcb_ (5tvc B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2074176Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2074177Protein automated matches [193506] (6 species)
    not a true protein
  7. 2074530Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)
  8. 2283525Domain d5tvcb_: 5tvc B: [326826]
    Other proteins in same PDB: d5tvca2, d5tvcc2, d5tvce2
    automated match to d2w8gc_
    complexed with 1pe, 7lb, so4

Details for d5tvcb_

PDB Entry: 5tvc (more details), 1.93 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with (e,2s)-n-methyl-5- (5-phenoxy-3-pyridyl)pent-4-en-2-amine (ti-5312)
PDB Compounds: (B:) Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d5tvcb_:

Sequence, based on SEQRES records: (download)

>d5tvcb_ b.96.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qykhdikyncceeiypdvvlvvkfre

Sequence, based on observed residues (ATOM records): (download)

>d5tvcb_ b.96.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnsl
mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhd
ikyncceeiypdvvlvvkfre

SCOPe Domain Coordinates for d5tvcb_:

Click to download the PDB-style file with coordinates for d5tvcb_.
(The format of our PDB-style files is described here.)

Timeline for d5tvcb_:

  • d5tvcb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01