SCOPe 2.06: Domain d5tp9b_: 5tp9 B:

Lineage for d5tp9b_ (5tp9 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)

7. Species Homo sapiens [TaxId:9606] [314718] (12 PDB entries)

8. Domain d5tp9b_: 5tp9 B: [326825]
   Other proteins in same PDB: d5tp9a_
   automated match to d5i2kb_
   complexed with 7h0, act, ca, glu, gly

Details for d5tp9b_

PDB Entry: 5tp9, 2.4 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with compound 2 (gne9178)

PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5tp9b_:

Sequence, based on SEQRES records:

>d5tp9b_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi
vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv
diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt
gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryq

Sequence, based on observed residues (ATOM records):

>d5tp9b_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryq

Timeline for d5tp9b_:

• d5tp9b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01