Lineage for d5ty0a1 (5ty0 A:2-286)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114421Species Legionella pneumophila [TaxId:272624] [261699] (4 PDB entries)
  8. 2283517Domain d5ty0a1: 5ty0 A:2-286 [326818]
    Other proteins in same PDB: d5ty0a2
    automated match to d1efga2
    complexed with bgc, na

Details for d5ty0a1

PDB Entry: 5ty0 (more details), 2.22 Å

PDB Description: 2.22 angstrom crystal structure of n-terminal fragment (residues 1- 419) of elongation factor g from legionella pneumophila.
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d5ty0a1:

Sequence, based on SEQRES records: (download)

>d5ty0a1 c.37.1.0 (A:2-286) automated matches {Legionella pneumophila [TaxId: 272624]}
atplklyrnigiaahvdagkttttervlyytgmshkigevhdgaatmdwmvqeqergiti
tsaattcywsgmdkqfeshriniidtpghvdfmieverslrvldgavvvfdsvagvepqs
etvwrqankygvprivfvnkmdrmganflrvvsqikqrlgstpvvlqlpigaeeefkgvi
dlikmkaihwdeenkgmtfkyvdipadlkstceeyrahiieaaaeyseelmekylegeef
teaeikkalrhltitnkvvpvfcgsafknkgvqavldgvieylps

Sequence, based on observed residues (ATOM records): (download)

>d5ty0a1 c.37.1.0 (A:2-286) automated matches {Legionella pneumophila [TaxId: 272624]}
atplklyrnigiaahvdagkttttervlyytgmshtsaattcywsgmdkqfeshriniid
tpghvdfmieverslrvldgavvvfdsvagvepqsetvwrqankygvprivfvnkmdrmg
anflrvvsqikqrlgstpvvlqlpigaeeefkgvidlikmkaihwdeenkgmtfkyvdip
adlkstceeyrahiieaaaeyseelmekylegeefteaeikkalrhltitnkvvpvfcgs
afknkgvqavldgvieylps

SCOPe Domain Coordinates for d5ty0a1:

Click to download the PDB-style file with coordinates for d5ty0a1.
(The format of our PDB-style files is described here.)

Timeline for d5ty0a1:

  • d5ty0a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5ty0a2