SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ty0a1 (5ty0 A:2-286)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (125 species)
    not a true protein
  7. 2114421Species Legionella pneumophila [TaxId:272624] [261699] (4 PDB entries)
  8. 2283517Domain d5ty0a1: 5ty0 A:2-286 [326818]
    Other proteins in same PDB: d5ty0a2
    automated match to d1efga2
    complexed with bgc, na

Details for d5ty0a1

PDB Entry: 5ty0 (more details), 2.22 Å

PDB Description: 2.22 angstrom crystal structure of n-terminal fragment (residues 1- 419) of elongation factor g from legionella pneumophila.
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d5ty0a1:

Sequence, based on SEQRES records: (download)

>d5ty0a1 c.37.1.0 (A:2-286) automated matches {Legionella pneumophila [TaxId: 272624]}
atplklyrnigiaahvdagkttttervlyytgmshkigevhdgaatmdwmvqeqergiti
tsaattcywsgmdkqfeshriniidtpghvdfmieverslrvldgavvvfdsvagvepqs
etvwrqankygvprivfvnkmdrmganflrvvsqikqrlgstpvvlqlpigaeeefkgvi
dlikmkaihwdeenkgmtfkyvdipadlkstceeyrahiieaaaeyseelmekylegeef
teaeikkalrhltitnkvvpvfcgsafknkgvqavldgvieylps

Sequence, based on observed residues (ATOM records): (download)

>d5ty0a1 c.37.1.0 (A:2-286) automated matches {Legionella pneumophila [TaxId: 272624]}
atplklyrnigiaahvdagkttttervlyytgmshtsaattcywsgmdkqfeshriniid
tpghvdfmieverslrvldgavvvfdsvagvepqsetvwrqankygvprivfvnkmdrmg
anflrvvsqikqrlgstpvvlqlpigaeeefkgvidlikmkaihwdeenkgmtfkyvdip
adlkstceeyrahiieaaaeyseelmekylegeefteaeikkalrhltitnkvvpvfcgs
afknkgvqavldgvieylps

SCOPe Domain Coordinates for d5ty0a1:

Click to download the PDB-style file with coordinates for d5ty0a1.
(The format of our PDB-style files is described here.)

Timeline for d5ty0a1:

  • d5ty0a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5ty0a2