Lineage for d5tp9a_ (5tp9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145835Species Human (Homo sapiens) [TaxId:9606] [193730] (29 PDB entries)
  8. 2283516Domain d5tp9a_: 5tp9 A: [326817]
    Other proteins in same PDB: d5tp9b_
    automated match to d5i2ja_
    complexed with 7h0, act, ca, glu, gly

Details for d5tp9a_

PDB Entry: 5tp9 (more details), 2.4 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with compound 2 (gne9178)
PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5tp9a_:

Sequence, based on SEQRES records: (download)

>d5tp9a_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgyg
ialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records): (download)

>d5tp9a_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhlsivtleeapfvivedidetcvrntvpcrkfvkinnstnegmnvkkcckgfcidilkk
lsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdfsv
pfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhqym
tkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygial
qkgspwkrqidlallqfvgdgemeeletlwltgic

SCOPe Domain Coordinates for d5tp9a_:

Click to download the PDB-style file with coordinates for d5tp9a_.
(The format of our PDB-style files is described here.)

Timeline for d5tp9a_:

  • d5tp9a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01