Lineage for d5tria_ (5tri A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572036Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 protein domains)
  6. 2572350Protein automated matches [190260] (24 species)
    not a true protein
  7. 2572455Species Hepatitis C virus [TaxId:11103] [187048] (44 PDB entries)
  8. 2572520Domain d5tria_: 5tri A: [326814]
    automated match to d3q0za_
    protein/RNA complex; complexed with 23e, 7hm, so4

Details for d5tria_

PDB Entry: 5tri (more details), 2.3 Å

PDB Description: crystal structure of the hepatitis c virus ns5b rna-dependent rna polymerase in complex with 3-[(4-chlorophenyl)methoxy]-2-(1-oxo-1,3- dihydro-2h-isoindol-2-yl)benzoic acid
PDB Compounds: (A:) NS5B RNA-dependent RNA polymerase

SCOPe Domain Sequences for d5tria_:

Sequence, based on SEQRES records: (download)

>d5tria_ e.8.1.4 (A:) automated matches {Hepatitis C virus [TaxId: 11103]}
smsytwtgalitpcaaeetklpinalsnsllrhhnlvyattsrsaslrqkkvtfdrlqvl
ddhyrdvlkemkakastvkakllsveeackltpphsarskfgygakdvrnlsskavnhir
svwkdlledtetpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
tlpqavmgssygfqyspgqrveflvnawkakkcpmgfaydtrcfdstvtendirveesiy
qccdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkaa
aacraaklqdctmlvcgddlvvicesagtqedeaslrafteamtrysappgdppkpeydl
elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw
armilmthffsillaqeqlekaldcqiygacysiepldlpqiiqrlhglsafslhsyspg
einrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavrtklkltpip
aasqldlsswfvagysggdiyhsl

Sequence, based on observed residues (ATOM records): (download)

>d5tria_ e.8.1.4 (A:) automated matches {Hepatitis C virus [TaxId: 11103]}
smsytwtgalitpcvyattsrsaslrqkkvtfdrlqvlddhyrdvlkemkakastvkakl
lsveeackltpphsarskfgygakdvrnlsskavnhirsvwkdlledtetpidttimakn
evfcvqpekggrkparlivfpdlgvrvcekmalydvvstlpqavmgssygfqyspgqrve
flvnawkakkcpmgfaydtrcfdstvtendirveesiyqccdlapearqairslterlyi
ggpltnskgqncgyrrcrasgvlttscgntltcylkaaaacraaklqdctmlvcgddlvv
icesagtqedeaslrafteamtrysappgdppkpeydlelitscssnvsvahdasgkrvy
yltrdpttplaraawetarhtpvnswlgniimyaptlwarmilmthffsillaqeqleka
ldcqiygacysiepldlpqiiqrlhglsafslhsyspgeinrvasclrklgvpplrvwrh
rarsvrarllsqggraatcgkylfnwavrtklkltpipaasqldlsswfvagysggdiyh
sl

SCOPe Domain Coordinates for d5tria_:

Click to download the PDB-style file with coordinates for d5tria_.
(The format of our PDB-style files is described here.)

Timeline for d5tria_: