SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k9qo_ (5k9q O:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (115 PDB entries)
  8. 2283504Domain d5k9qo_: 5k9q O: [326805]
    Other proteins in same PDB: d5k9qb_, d5k9qd_, d5k9qf_, d5k9qi1, d5k9qi2, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qn_, d5k9qp_, d5k9qr_, d5k9qt1, d5k9qt2, d5k9qv1, d5k9qv2, d5k9qy1, d5k9qy2
    automated match to d2ypgc_
    complexed with nag

Details for d5k9qo_

PDB Entry: 5k9q (more details), 2.5 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.a.26 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (O:) hemagglutinin HA1

SCOPe Domain Sequences for d5k9qo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9qo_ b.19.1.2 (O:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst
nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins
ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqntlklatgmrnvpe

SCOPe Domain Coordinates for d5k9qo_:

Click to download the PDB-style file with coordinates for d5k9qo_.
(The format of our PDB-style files is described here.)

Timeline for d5k9qo_:

  • d5k9qo_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01