SCOPe 2.08: Domain d5tvca1: 5tvc A:1-213

Lineage for d5tvca1 (5tvc A:1-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)

8. Domain d5tvca1: 5tvc A:1-213 [326795]
   Other proteins in same PDB: d5tvca2, d5tvcc2, d5tvce2
   automated match to d2w8gc_
   complexed with 1pe, 7lb, so4

Details for d5tvca1

PDB Entry: 5tvc, 1.93 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with (e,2s)-n-methyl-5- (5-phenoxy-3-pyridyl)pent-4-en-2-amine (ti-5312)

PDB Compounds: (A:) Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d5tvca1:

Sequence, based on SEQRES records:

>d5tvca1 b.96.1.0 (A:1-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qykhdikyncceeiypdvvlvvkfrerragngf

Sequence, based on observed residues (ATOM records):

>d5tvca1 b.96.1.0 (A:1-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnsl
mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhd
ikyncceeiypdvvlvvkfrerragngf

Timeline for d5tvca1:

• d5tvca1 first appeared in SCOPe 2.06
  
• d5tvca1 appears in SCOPe 2.07