SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpaa_ (5tpa A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2145835Species Human (Homo sapiens) [TaxId:9606] [193730] (28 PDB entries)
  8. 2283492Domain d5tpaa_: 5tpa A: [326793]
    Other proteins in same PDB: d5tpab_
    automated match to d5i2ja_
    complexed with 7h2, glu, gly

Details for d5tpaa_

PDB Entry: 5tpa (more details), 2.48 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with compound 9 (gne3500)
PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5tpaa_:

Sequence, based on SEQRES records: (download)

>d5tpaa_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgyg
ialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records): (download)

>d5tpaa_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhlsivtleeapfvivedidetcvrntvpcrkfvkinnstnegmnvkkcckgfcidilkk
lsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdfsv
pfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhqym
tkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygial
qkgspwkrqidlallqfvgdgemeeletlwltgic

SCOPe Domain Coordinates for d5tpaa_:

Click to download the PDB-style file with coordinates for d5tpaa_.
(The format of our PDB-style files is described here.)

Timeline for d5tpaa_:

  • d5tpaa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01