SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tt7a1 (5tt7 A:358-635)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198049Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2198050Species Human (Homo sapiens) [TaxId:9606] [118132] (60 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 2283490Domain d5tt7a1: 5tt7 A:358-635 [326791]
    Other proteins in same PDB: d5tt7a2
    automated match to d3tuca_
    complexed with 7kf

Details for d5tt7a1

PDB Entry: 5tt7 (more details), 1.77 Å

PDB Description: discovery of tak-659, an orally available investigational inhibitor of spleen tyrosine kinase (syk)
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d5tt7a1:

Sequence, based on SEQRES records: (download)

>d5tt7a1 d.144.1.7 (A:358-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
irpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdel
laeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhq
vsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvk
wyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagc
premydlmnlcwtydvenrpgfaavelrlrnyyydvvn

Sequence, based on observed residues (ATOM records): (download)

>d5tt7a1 d.144.1.7 (A:358-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
irpkevyldrklltledkelgsgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmq
qldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyl
eesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecin
yykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlm
nlcwtydvenrpgfaavelrlrnyyydvvn

SCOPe Domain Coordinates for d5tt7a1:

Click to download the PDB-style file with coordinates for d5tt7a1.
(The format of our PDB-style files is described here.)

Timeline for d5tt7a1:

  • d5tt7a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5tt7a2