Lineage for d5t5nf2 (5t5n F:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753344Domain d5t5nf2: 5t5n F:108-212 [326790]
    Other proteins in same PDB: d5t5nf1, d5t5ng1, d5t5ng2, d5t5nh1, d5t5ni1, d5t5ni2, d5t5nj1, d5t5nk1, d5t5nk2, d5t5nl1, d5t5nm1, d5t5nm2, d5t5nn1, d5t5no1, d5t5no2
    automated match to d1p7kl2
    complexed with ca, cl, gol, k; mutant

Details for d5t5nf2

PDB Entry: 5t5n (more details), 3.1 Å

PDB Description: calcium-activated chloride channel bestrophin-1 (best1), triple mutant: i76a, f80a, f84a; in complex with an fab antibody fragment, chloride, and calcium
PDB Compounds: (F:) Fab antibody fragment, light chain (10D10)

SCOPe Domain Sequences for d5t5nf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t5nf2 b.1.1.2 (F:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5t5nf2:

Click to download the PDB-style file with coordinates for d5t5nf2.
(The format of our PDB-style files is described here.)

Timeline for d5t5nf2: