SCOPe 2.08: Domain d5t5nf1: 5t5n F:1-107

Lineage for d5t5nf1 (5t5n F:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5t5nf1: 5t5n F:1-107 [326789]
   Other proteins in same PDB: d5t5nf2, d5t5ng1, d5t5ng2, d5t5nh2, d5t5ni1, d5t5ni2, d5t5nj2, d5t5nk1, d5t5nk2, d5t5nl2, d5t5nm1, d5t5nm2, d5t5nn2, d5t5no1, d5t5no2
   automated match to d1kegl1
   complexed with ca, cl, gol, k; mutant

Details for d5t5nf1

PDB Entry: 5t5n, 3.1 Å

PDB Description: calcium-activated chloride channel bestrophin-1 (best1), triple mutant: i76a, f80a, f84a; in complex with an fab antibody fragment, chloride, and calcium

PDB Compounds: (F:) Fab antibody fragment, light chain (10D10)

SCOPe Domain Sequences for d5t5nf1:

Sequence; same for both SEQRES and ATOM records:

>d5t5nf1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktltegvps
rfsgsgsgtqfslkinslqpedfggyfcqhhygtpptfgggtklevk

Timeline for d5t5nf1:

• d5t5nf1 first appeared in SCOPe 2.06
  
• d5t5nf1 appears in SCOPe 2.07