SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t3ga_ (5t3g A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041900Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2041901Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2041902Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 protein domains)
    automatically mapped to Pfam PF00314
  6. 2041910Protein Thaumatin [49876] (1 species)
  7. 2041911Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (84 PDB entries)
    Uniprot P02883
  8. 2283487Domain d5t3ga_: 5t3g A: [326788]
    automated match to d1kwna_
    complexed with sey, tla

Details for d5t3ga_

PDB Entry: 5t3g (more details), 1.55 Å

PDB Description: thaumatin soaked with selenourea for 10 min
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d5t3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t3ga_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpt

SCOPe Domain Coordinates for d5t3ga_:

Click to download the PDB-style file with coordinates for d5t3ga_.
(The format of our PDB-style files is described here.)

Timeline for d5t3ga_:

  • d5t3ga_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01