Lineage for d5m7ya_ (5m7y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004252Family a.102.1.8: CPF0428-like [158737] (3 protein domains)
    Pfam PF06824; DUF1237
  6. 2004257Protein Hypothetical protein CPF0428 [158740] (2 species)
  7. 2283470Species Clostridium perfringens [TaxId:195102] [326771] (2 PDB entries)
  8. 2283482Domain d5m7ya_: 5m7y A: [326783]
    automated match to d3qt3a_
    complexed with man, mg; mutant

Details for d5m7ya_

PDB Entry: 5m7y (more details), 1.55 Å

PDB Description: crystal structure of gh125 1,6-alpha-mannosidase mutant from clostridium perfringens in complex with 1,6-alpha-mannotriose
PDB Compounds: (A:) 1,6-alpha-mannosidase

SCOPe Domain Sequences for d5m7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7ya_ a.102.1.8 (A:) Hypothetical protein CPF0428 {Clostridium perfringens [TaxId: 195102]}
slstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipam
wlrdstsqvehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdndit
kdspwvwerkyeidslcypvrlihkywkesgdetffnddikkafnmiidlwrveqyhrek
sdysfqrlncsvtdtlsheglgtpvtytgmtwsgfrpsndaceygylipanmfavvalry
iseiaekvykdeelkekadslreeidnaiekhgkvykegfgevyayetdgmgnynfmdda
nvpsllsipyleykgiedevyqntrkfilsknnrfffegkaakgigsphtpdqyiwhial
smqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnslfshfiye
kvink

SCOPe Domain Coordinates for d5m7ya_:

Click to download the PDB-style file with coordinates for d5m7ya_.
(The format of our PDB-style files is described here.)

Timeline for d5m7ya_:

  • d5m7ya_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01