SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m7ya_ (5m7y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004252Family a.102.1.8: CPF0428-like [158737] (3 protein domains)
    Pfam PF06824; DUF1237
  6. 2004257Protein Hypothetical protein CPF0428 [158740] (2 species)
  7. 2283470Species Clostridium perfringens [TaxId:195102] [326771] (2 PDB entries)
  8. 2283482Domain d5m7ya_: 5m7y A: [326783]
    automated match to d3qt3a_
    complexed with man, mg; mutant

Details for d5m7ya_

PDB Entry: 5m7y (more details), 1.55 Å

PDB Description: crystal structure of gh125 1,6-alpha-mannosidase mutant from clostridium perfringens in complex with 1,6-alpha-mannotriose
PDB Compounds: (A:) 1,6-alpha-mannosidase

SCOPe Domain Sequences for d5m7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7ya_ a.102.1.8 (A:) Hypothetical protein CPF0428 {Clostridium perfringens [TaxId: 195102]}
slstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipam
wlrdstsqvehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdndit
kdspwvwerkyeidslcypvrlihkywkesgdetffnddikkafnmiidlwrveqyhrek
sdysfqrlncsvtdtlsheglgtpvtytgmtwsgfrpsndaceygylipanmfavvalry
iseiaekvykdeelkekadslreeidnaiekhgkvykegfgevyayetdgmgnynfmdda
nvpsllsipyleykgiedevyqntrkfilsknnrfffegkaakgigsphtpdqyiwhial
smqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnslfshfiye
kvink

SCOPe Domain Coordinates for d5m7ya_:

Click to download the PDB-style file with coordinates for d5m7ya_.
(The format of our PDB-style files is described here.)

Timeline for d5m7ya_:

  • d5m7ya_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01