SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t5nn2 (5t5n N:108-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (462 PDB entries)
  8. 2283480Domain d5t5nn2: 5t5n N:108-212 [326781]
    Other proteins in same PDB: d5t5nf1, d5t5nh1, d5t5nj1, d5t5nl1, d5t5nn1
    automated match to d1p7kl2
    complexed with ca, cl, gol, k; mutant

Details for d5t5nn2

PDB Entry: 5t5n (more details), 3.1 Å

PDB Description: calcium-activated chloride channel bestrophin-1 (best1), triple mutant: i76a, f80a, f84a; in complex with an fab antibody fragment, chloride, and calcium
PDB Compounds: (N:) Fab antibody fragment, light chain (10D10)

SCOPe Domain Sequences for d5t5nn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t5nn2 b.1.1.2 (N:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5t5nn2:

Click to download the PDB-style file with coordinates for d5t5nn2.
(The format of our PDB-style files is described here.)

Timeline for d5t5nn2:

  • d5t5nn2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-01