SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m3qa_ (5m3q A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191684Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2191685Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2191686Family d.126.1.1: Ribosome anti-association factor eIF6 (aIF6) [55910] (2 protein domains)
    automatically mapped to Pfam PF01912
  6. 2283476Protein automated matches [326777] (1 species)
    not a true protein
  7. 2283477Species Chaetomium thermophilum [TaxId:759272] [326778] (1 PDB entry)
  8. 2283478Domain d5m3qa_: 5m3q A: [326779]
    automated match to d1g62a_
    complexed with gol, so4

Details for d5m3qa_

PDB Entry: 5m3q (more details), 1.5 Å

PDB Description: crystal structure of tif6 from chaetomium thermophilum
PDB Compounds: (A:) eukaryotic translation initiation factor 6

SCOPe Domain Sequences for d5m3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m3qa_ d.126.1.1 (A:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
avraqfensnevgvfatltnsyclvalgasenfysvfeaelqdvipicrttiagtriigr
ltagnrkgllvpttttdqelqhlrnslpddiriqrieerlsalgnvivcndhtalihpdl
ereteeiiadvlgvevfrqtiadhvlvgsymalsnqgglvhpktsiqdqdelssllgvpl
vagsvnrgsnvigggmvvndwlavtgldttapelsviesvfrlg

SCOPe Domain Coordinates for d5m3qa_:

Click to download the PDB-style file with coordinates for d5m3qa_.
(The format of our PDB-style files is described here.)

Timeline for d5m3qa_:

  • d5m3qa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01