Lineage for d5m3qa_ (5m3q A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191684Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2191685Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2191686Family d.126.1.1: Ribosome anti-association factor eIF6 (aIF6) [55910] (2 protein domains)
    automatically mapped to Pfam PF01912
  6. 2283476Protein automated matches [326777] (1 species)
    not a true protein
  7. 2283477Species Chaetomium thermophilum [TaxId:759272] [326778] (1 PDB entry)
  8. 2283478Domain d5m3qa_: 5m3q A: [326779]
    automated match to d1g62a_
    complexed with gol, so4

Details for d5m3qa_

PDB Entry: 5m3q (more details), 1.5 Å

PDB Description: crystal structure of tif6 from chaetomium thermophilum
PDB Compounds: (A:) eukaryotic translation initiation factor 6

SCOPe Domain Sequences for d5m3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m3qa_ d.126.1.1 (A:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
avraqfensnevgvfatltnsyclvalgasenfysvfeaelqdvipicrttiagtriigr
ltagnrkgllvpttttdqelqhlrnslpddiriqrieerlsalgnvivcndhtalihpdl
ereteeiiadvlgvevfrqtiadhvlvgsymalsnqgglvhpktsiqdqdelssllgvpl
vagsvnrgsnvigggmvvndwlavtgldttapelsviesvfrlg

SCOPe Domain Coordinates for d5m3qa_:

Click to download the PDB-style file with coordinates for d5m3qa_.
(The format of our PDB-style files is described here.)

Timeline for d5m3qa_:

  • d5m3qa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01