SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tvcd_ (5tvc D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2074176Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2074177Protein automated matches [193506] (6 species)
    not a true protein
  7. 2074530Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)
  8. 2283472Domain d5tvcd_: 5tvc D: [326773]
    Other proteins in same PDB: d5tvca2, d5tvcc2, d5tvce2
    automated match to d2w8gc_
    complexed with 1pe, 7lb, so4

Details for d5tvcd_

PDB Entry: 5tvc (more details), 1.93 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with (e,2s)-n-methyl-5- (5-phenoxy-3-pyridyl)pent-4-en-2-amine (ti-5312)
PDB Compounds: (D:) Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d5tvcd_:

Sequence, based on SEQRES records: (download)

>d5tvcd_ b.96.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
ykhdikyncceeiypdvvlvvkfre

Sequence, based on observed residues (ATOM records): (download)

>d5tvcd_ b.96.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqanlmrlksdlypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnslmw
dpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsfmc
dptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhdik
yncceeiypdvvlvvkfre

SCOPe Domain Coordinates for d5tvcd_:

Click to download the PDB-style file with coordinates for d5tvcd_.
(The format of our PDB-style files is described here.)

Timeline for d5tvcd_:

  • d5tvcd_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01