Lineage for d5f0za_ (5f0z A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137961Species Vibrio cholerae [TaxId:345073] [269172] (6 PDB entries)
  8. 2283465Domain d5f0za_: 5f0z A: [326766]
    automated match to d1v1aa_
    complexed with adp, ca, fru, na

Details for d5f0za_

PDB Entry: 5f0z (more details), 1.75 Å

PDB Description: crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp and calcium ion bound form
PDB Compounds: (A:) fructokinase

SCOPe Domain Sequences for d5f0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f0za_ c.72.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
dsmsrvwltgdavvdlipdgqqhylkcpggapanvavaiarlsgrsaffgrvgndpfgrf
mqqtltdeqvdcqhlhfdpvhrtstvvvdldehgersftfmvkpsadqflqlsdipsfqk
gewlhvcsialanqpsrsstfaaiaqmkevggyvsfdpnlreevwsepqelqatvmravg
ladvvkfseeelqfltgtqsieeglqaiadfqiplvvvtlgakgalvatpnsqqivsgka
vkpidttgagdafvggllyrlsvaqdwhnqatildavkwangcgalattqkgamtalpnq
aalyafle

SCOPe Domain Coordinates for d5f0za_:

Click to download the PDB-style file with coordinates for d5f0za_.
(The format of our PDB-style files is described here.)

Timeline for d5f0za_:

  • d5f0za_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30