SCOPe 2.06: Domain d5kank2: 5kan K:110-214

Lineage for d5kank2 (5kan K:110-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5kank2: 5kan K:110-214 [326761]
   Other proteins in same PDB: d5kana_, d5kanb_, d5kanc_, d5kand_, d5kane_, d5kanf_, d5kani1, d5kank1, d5kanl1
   automated match to d1gafl2
   complexed with nag

Details for d5kank2

PDB Entry: 5kan, 2.79 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin

PDB Compounds: (K:) 16.g.07 Light chain

SCOPe Domain Sequences for d5kank2:

Sequence; same for both SEQRES and ATOM records:

>d5kank2 b.1.1.2 (K:110-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

Timeline for d5kank2:

• d5kank2 is new in SCOPe 2.06-stable
  
• d5kank2 appears in SCOPe 2.07
  
• d5kank2 appears in the current release, SCOPe 2.08