Lineage for d2hnq__ (2hnq -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24013Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 24014Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
  5. 24024Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 24035Protein Tyrosine phosphatase [52806] (6 species)
  7. 24036Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (24 PDB entries)
  8. 24058Domain d2hnq__: 2hnq - [32676]

Details for d2hnq__

PDB Entry: 2hnq (more details), 2.8 Å

PDB Description: crystal structure of human protein tyrosine phosphatase 1b
PDB Compounds: ( :)

SCOP Domain Sequences for d2hnq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hnq__ c.45.1.2 (-) Tyrosine phosphatase {Human (Homo sapiens), 1B}
kefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqedn
dyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkcaqy
wpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgv
pespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssv
dikkvllemrkfrmgliqtadqlrfsylaviegakfim

SCOP Domain Coordinates for d2hnq__:

Click to download the PDB-style file with coordinates for d2hnq__.
(The format of our PDB-style files is described here.)

Timeline for d2hnq__: