SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5love_ (5lov E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012522Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2012523Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2012524Protein Stathmin 4 [101496] (1 species)
  7. 2012525Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (51 PDB entries)
  8. 2283457Domain d5love_: 5lov E: [326758]
    Other proteins in same PDB: d5lova1, d5lova2, d5lovb1, d5lovb2, d5lovc1, d5lovc2, d5lovd1, d5lovd2, d5lovf1, d5lovf2
    automated match to d4i55e_
    complexed with 71e, acp, ca, gdp, gtp, mes, mg

Details for d5love_

PDB Entry: 5lov (more details), 2.4 Å

PDB Description: dz-2384 tubulin complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5love_:

Sequence, based on SEQRES records: (download)

>d5love_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqeae
llkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekd
khaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5love_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vielnkctsgqsfevilkpdpsleeiqkkleaaeerrkyqeaellkhlaekrehereviq
kaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

SCOPe Domain Coordinates for d5love_:

Click to download the PDB-style file with coordinates for d5love_.
(The format of our PDB-style files is described here.)

Timeline for d5love_:

  • d5love_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01