Lineage for d5t3ja_ (5t3j A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2219721Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2219722Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2220030Family e.7.1.0: automated matches [191440] (1 protein)
    not a true family
  6. 2220031Protein automated matches [190647] (11 species)
    not a true protein
  7. 2270439Species Medicago truncatula [TaxId:3880] [313744] (5 PDB entries)
  8. 2283455Domain d5t3ja_: 5t3j A: [326756]
    automated match to d5eq9b_
    complexed with po4, sey

Details for d5t3ja_

PDB Entry: 5t3j (more details), 2.55 Å

PDB Description: histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min
PDB Compounds: (A:) inositol monophosphatase

SCOPe Domain Sequences for d5t3ja_:

Sequence, based on SEQRES records: (download)

>d5t3ja_ e.7.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
pphqlnhfsdvankaanaagdvirkyfrknnfdiihkndlspvtiadqsaeeamvsvild
nfpshavygeekgwrckqdsadyvwvldpidgtksfitgkplfgtliallqngtpilgii
dqpvlkerwigitgkrttlngqevstrtcadlsqaylyttsphlfsgdaeeafirvrdkv
kiplygcdcyayallssgfvdlvvesglkpydflalipviegsggvitdwkghqlrweas
plsiatsfnvvaagdkqihqqaldslqw

Sequence, based on observed residues (ATOM records): (download)

>d5t3ja_ e.7.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
pphqlnhfsdvankaanaagdvirkyfrkspvtiadqsaeeamvsvildnfpshavygee
kgwrckqdsadyvwvldpidgtksfitgkplfgtliallqngtpilgiidqpvlkerwig
itgkrttlngqevstrtcadlsqaylyttsphlfsgdaeeafirvrdkvkiplygcdcya
yallssgfvdlvvesglkpydflalipviegsggvitdwkghqlrweasplsiatsfnvv
aagdkqihqqaldslqw

SCOPe Domain Coordinates for d5t3ja_:

Click to download the PDB-style file with coordinates for d5t3ja_.
(The format of our PDB-style files is described here.)

Timeline for d5t3ja_:

  • d5t3ja_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30