SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t3ja_ (5t3j A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2219721Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2219722Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2220030Family e.7.1.0: automated matches [191440] (1 protein)
    not a true family
  6. 2220031Protein automated matches [190647] (10 species)
    not a true protein
  7. 2270439Species Medicago truncatula [TaxId:3880] [313744] (5 PDB entries)
  8. 2283455Domain d5t3ja_: 5t3j A: [326756]
    automated match to d5eq9b_
    complexed with po4, sey

Details for d5t3ja_

PDB Entry: 5t3j (more details), 2.55 Å

PDB Description: histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min
PDB Compounds: (A:) inositol monophosphatase

SCOPe Domain Sequences for d5t3ja_:

Sequence, based on SEQRES records: (download)

>d5t3ja_ e.7.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
pphqlnhfsdvankaanaagdvirkyfrknnfdiihkndlspvtiadqsaeeamvsvild
nfpshavygeekgwrckqdsadyvwvldpidgtksfitgkplfgtliallqngtpilgii
dqpvlkerwigitgkrttlngqevstrtcadlsqaylyttsphlfsgdaeeafirvrdkv
kiplygcdcyayallssgfvdlvvesglkpydflalipviegsggvitdwkghqlrweas
plsiatsfnvvaagdkqihqqaldslqw

Sequence, based on observed residues (ATOM records): (download)

>d5t3ja_ e.7.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
pphqlnhfsdvankaanaagdvirkyfrkspvtiadqsaeeamvsvildnfpshavygee
kgwrckqdsadyvwvldpidgtksfitgkplfgtliallqngtpilgiidqpvlkerwig
itgkrttlngqevstrtcadlsqaylyttsphlfsgdaeeafirvrdkvkiplygcdcya
yallssgfvdlvvesglkpydflalipviegsggvitdwkghqlrweasplsiatsfnvv
aagdkqihqqaldslqw

SCOPe Domain Coordinates for d5t3ja_:

Click to download the PDB-style file with coordinates for d5t3ja_.
(The format of our PDB-style files is described here.)

Timeline for d5t3ja_:

  • d5t3ja_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30