SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g0ta_ (5g0t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091104Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2091223Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (70 PDB entries)
  8. 2283454Domain d5g0ta_: 5g0t A: [326755]
    automated match to d1p44a_
    protein/DNA complex; complexed with nad, s72

Details for d5g0ta_

PDB Entry: 5g0t (more details), 1.54 Å

PDB Description: inha in complex with a dna encoded library hit
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d5g0ta_:

Sequence, based on SEQRES records: (download)

>d5g0ta_ c.2.1.2 (A:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
callsdwlpattgdiiyadggahtqll

Sequence, based on observed residues (ATOM records): (download)

>d5g0ta_ c.2.1.2 (A:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlgalgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdw
lpattgdiiyadggahtqll

SCOPe Domain Coordinates for d5g0ta_:

Click to download the PDB-style file with coordinates for d5g0ta_.
(The format of our PDB-style files is described here.)

Timeline for d5g0ta_:

  • d5g0ta_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01