SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5eyta_ (5eyt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (17 species)
    not a true protein
  7. 2283308Species Schistosoma mansoni [TaxId:6183] [326609] (2 PDB entries)
  8. 2283446Domain d5eyta_: 5eyt A: [326747]
    automated match to d2vd6b_
    complexed with amp

Details for d5eyta_

PDB Entry: 5eyt (more details), 2.36 Å

PDB Description: crystal structure of adenylosuccinate lyase from schistosoma mansoni in complex with amp
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d5eyta_:

Sequence, based on SEQRES records: (download)

>d5eyta_ a.127.1.0 (A:) automated matches {Schistosoma mansoni [TaxId: 6183]}
efeeyrnpltkryasremvcnfgekrkvilwrqlwiwlaetqkelgfditdeqinemksq
rdsvdfgtaaaeekarrhdvmahvytfalacpkaapiihlgatscfvgdnadlimlkdgl
nillpkvarcidrlakkamlhksliclarthlqpaqpttmgrricmwiqdllldlenler
lknhtirfrgakgavgtqasfmdlfqgdhqkvikldeiltkksgfqrswcvtgqtyprkv
dieitnalsnigatvhkictdirllssfheveepfetkqigssampykrnpirseracsl
arylmhistsmvstvsvqwlerslddsairrivlpeaflaadacltllqniaeglivypm
vmeanlnselpflvverilvkmvsegaanrqecherlrkhsheaaaeiklkglknslmdk
llndyyfapihsllptvldpsymigraveqvevflntevdpaihsykdclalnsniti

Sequence, based on observed residues (ATOM records): (download)

>d5eyta_ a.127.1.0 (A:) automated matches {Schistosoma mansoni [TaxId: 6183]}
efeeyrnpltkryasremvcnfgekrkvilwrqlwiwlaetqkelgfditdeqinemksq
rdsvdfgtaaaeekarrhdvmahvytfalacpkaapiihlgatscfvgdnadlimlkdgl
nillpkvarcidrlakkamlhksliclarthlqpaqpttmgrricmwiqdllldlenler
lknhtirfrgakgavgtqasfmdlfqgdhqkvikldeiltkksgfqrswcvtgqtyprkv
dieitnalsnigatvhkictdirllssfheveepfetkmpykrnpirseracslarylmh
istsmvstvsvqwlerslddsairrivlpeaflaadacltllqniaeglivypmvmeanl
nselpflvverilvkmvsegaanrqecherlrkhsheaaaeiklkglknslmdkllndyy
fapihsllptvldpsymigraveqvevflntevdpaihsykdclalnsniti

SCOPe Domain Coordinates for d5eyta_:

Click to download the PDB-style file with coordinates for d5eyta_.
(The format of our PDB-style files is described here.)

Timeline for d5eyta_:

  • d5eyta_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30