Lineage for d5eyta_ (5eyt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (19 species)
    not a true protein
  7. 2283308Species Schistosoma mansoni [TaxId:6183] [326609] (2 PDB entries)
  8. 2283446Domain d5eyta_: 5eyt A: [326747]
    automated match to d2vd6b_
    complexed with amp

Details for d5eyta_

PDB Entry: 5eyt (more details), 2.36 Å

PDB Description: crystal structure of adenylosuccinate lyase from schistosoma mansoni in complex with amp
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d5eyta_:

Sequence, based on SEQRES records: (download)

>d5eyta_ a.127.1.0 (A:) automated matches {Schistosoma mansoni [TaxId: 6183]}
efeeyrnpltkryasremvcnfgekrkvilwrqlwiwlaetqkelgfditdeqinemksq
rdsvdfgtaaaeekarrhdvmahvytfalacpkaapiihlgatscfvgdnadlimlkdgl
nillpkvarcidrlakkamlhksliclarthlqpaqpttmgrricmwiqdllldlenler
lknhtirfrgakgavgtqasfmdlfqgdhqkvikldeiltkksgfqrswcvtgqtyprkv
dieitnalsnigatvhkictdirllssfheveepfetkqigssampykrnpirseracsl
arylmhistsmvstvsvqwlerslddsairrivlpeaflaadacltllqniaeglivypm
vmeanlnselpflvverilvkmvsegaanrqecherlrkhsheaaaeiklkglknslmdk
llndyyfapihsllptvldpsymigraveqvevflntevdpaihsykdclalnsniti

Sequence, based on observed residues (ATOM records): (download)

>d5eyta_ a.127.1.0 (A:) automated matches {Schistosoma mansoni [TaxId: 6183]}
efeeyrnpltkryasremvcnfgekrkvilwrqlwiwlaetqkelgfditdeqinemksq
rdsvdfgtaaaeekarrhdvmahvytfalacpkaapiihlgatscfvgdnadlimlkdgl
nillpkvarcidrlakkamlhksliclarthlqpaqpttmgrricmwiqdllldlenler
lknhtirfrgakgavgtqasfmdlfqgdhqkvikldeiltkksgfqrswcvtgqtyprkv
dieitnalsnigatvhkictdirllssfheveepfetkmpykrnpirseracslarylmh
istsmvstvsvqwlerslddsairrivlpeaflaadacltllqniaeglivypmvmeanl
nselpflvverilvkmvsegaanrqecherlrkhsheaaaeiklkglknslmdkllndyy
fapihsllptvldpsymigraveqvevflntevdpaihsykdclalnsniti

SCOPe Domain Coordinates for d5eyta_:

Click to download the PDB-style file with coordinates for d5eyta_.
(The format of our PDB-style files is described here.)

Timeline for d5eyta_:

  • d5eyta_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30