Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5k9qy2: 5k9q Y:107-214 [326746] Other proteins in same PDB: d5k9qa_, d5k9qb_, d5k9qc_, d5k9qd_, d5k9qe_, d5k9qf_, d5k9qg_, d5k9qh_, d5k9qi1, d5k9qj_, d5k9qk1, d5k9ql1, d5k9qm_, d5k9qn_, d5k9qo_, d5k9qp_, d5k9qq_, d5k9qr_, d5k9qs_, d5k9qt1, d5k9qu_, d5k9qv1, d5k9qx_, d5k9qy1 automated match to d1dn0a2 complexed with nag |
PDB Entry: 5k9q (more details), 2.5 Å
SCOPe Domain Sequences for d5k9qy2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k9qy2 b.1.1.2 (Y:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d5k9qy2:
View in 3D Domains from other chains: (mouse over for more information) d5k9qa_, d5k9qb_, d5k9qc_, d5k9qd_, d5k9qe_, d5k9qf_, d5k9qg_, d5k9qh_, d5k9qi1, d5k9qi2, d5k9qj_, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qm_, d5k9qn_, d5k9qo_, d5k9qp_, d5k9qq_, d5k9qr_, d5k9qs_, d5k9qt1, d5k9qt2, d5k9qu_, d5k9qv1, d5k9qv2, d5k9qx_ |