SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5eyna_ (5eyn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137961Species Vibrio cholerae [TaxId:345073] [269172] (6 PDB entries)
  8. 2283437Domain d5eyna_: 5eyn A: [326738]
    automated match to d1v1aa_
    complexed with adp, bef, ca, fru, na

Details for d5eyna_

PDB Entry: 5eyn (more details), 1.29 Å

PDB Description: crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
PDB Compounds: (A:) fructokinase

SCOPe Domain Sequences for d5eyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eyna_ c.72.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
msrvwltgdavvdlipdgqqhylkcpggapanvavaiarlsgrsaffgrvgndpfgrfmq
qtltdeqvdcqhlhfdpvhrtstvvvdldehgersftfmvkpsadqflqlsdipsfqkge
wlhvcsialanqpsrsstfaaiaqmkevggyvsfdpnlreevwsepqelqatvmravgla
dvvkfseeelqfltgtqsieeglqaiadfqiplvvvtlgakgalvatpnsqqivsgkavk
pidttgagdafvggllyrlsvaqdwhnqatildavkwangcgalattqkgamtalpnqaa
lyafle

SCOPe Domain Coordinates for d5eyna_:

Click to download the PDB-style file with coordinates for d5eyna_.
(The format of our PDB-style files is described here.)

Timeline for d5eyna_:

  • d5eyna_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30