Lineage for d5eyna_ (5eyn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137961Species Vibrio cholerae [TaxId:345073] [269172] (6 PDB entries)
  8. 2283437Domain d5eyna_: 5eyn A: [326738]
    automated match to d1v1aa_
    complexed with adp, bef, ca, fru, na

Details for d5eyna_

PDB Entry: 5eyn (more details), 1.29 Å

PDB Description: crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
PDB Compounds: (A:) fructokinase

SCOPe Domain Sequences for d5eyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eyna_ c.72.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
msrvwltgdavvdlipdgqqhylkcpggapanvavaiarlsgrsaffgrvgndpfgrfmq
qtltdeqvdcqhlhfdpvhrtstvvvdldehgersftfmvkpsadqflqlsdipsfqkge
wlhvcsialanqpsrsstfaaiaqmkevggyvsfdpnlreevwsepqelqatvmravgla
dvvkfseeelqfltgtqsieeglqaiadfqiplvvvtlgakgalvatpnsqqivsgkavk
pidttgagdafvggllyrlsvaqdwhnqatildavkwangcgalattqkgamtalpnqaa
lyafle

SCOPe Domain Coordinates for d5eyna_:

Click to download the PDB-style file with coordinates for d5eyna_.
(The format of our PDB-style files is described here.)

Timeline for d5eyna_:

  • d5eyna_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30