Lineage for d5ls9i_ (5ls9 I:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (37 species)
    not a true protein
  7. 1990539Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries)
  8. 2283434Domain d5ls9i_: 5ls9 I: [326735]
    automated match to d2x17m_
    complexed with mg

Details for d5ls9i_

PDB Entry: 5ls9 (more details), 2.93 Å

PDB Description: humanized archaeal ferritin
PDB Compounds: (I:) Ferritin, putative

SCOPe Domain Sequences for d5ls9i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ls9i_ a.25.1.0 (I:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrqf

SCOPe Domain Coordinates for d5ls9i_:

Click to download the PDB-style file with coordinates for d5ls9i_.
(The format of our PDB-style files is described here.)

Timeline for d5ls9i_:

  • d5ls9i_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30