SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k9qd_ (5k9q D:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2238936Protein Influenza hemagglutinin (stalk) [58066] (11 species)
    trimer
  7. 2238958Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2283433Domain d5k9qd_: 5k9q D: [326734]
    Other proteins in same PDB: d5k9qa_, d5k9qc_, d5k9qe_, d5k9qi1, d5k9qi2, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qm_, d5k9qo_, d5k9qq_, d5k9qt1, d5k9qt2, d5k9qv1, d5k9qv2, d5k9qy1, d5k9qy2
    automated match to d3vunb_
    complexed with nag

Details for d5k9qd_

PDB Entry: 5k9q (more details), 2.5 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.a.26 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d5k9qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9qd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
fgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnek
fhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfekt
rrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5k9qd_:

Click to download the PDB-style file with coordinates for d5k9qd_.
(The format of our PDB-style files is described here.)

Timeline for d5k9qd_:

  • d5k9qd_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-01