SCOPe 2.06: Domain d5ja7b_: 5ja7 B:

Lineage for d5ja7b_ (5ja7 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (42 PDB entries)

8. Domain d5ja7b_: 5ja7 B: [326729]
   automated match to d4lega_
   complexed with 6hm, act, gol, so4; mutant

Details for d5ja7b_

PDB Entry: 5ja7, 1.61 Å

PDB Description: human cathepsin k mutant c25s in complex with the allosteric effector nsc94914

PDB Compounds: (B:) cathepsin k

SCOPe Domain Sequences for d5ja7b_:

Sequence; same for both SEQRES and ATOM records:

>d5ja7b_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d5ja7b_:

• d5ja7b_ is new in SCOPe 2.06-stable
  
• d5ja7b_ appears in SCOPe 2.07
  
• d5ja7b_ appears in the current release, SCOPe 2.08