SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ja7b_ (5ja7 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155438Species Human (Homo sapiens) [TaxId:9606] [187072] (40 PDB entries)
  8. 2283428Domain d5ja7b_: 5ja7 B: [326729]
    automated match to d4lega_
    complexed with 6hm, act, gol, so4; mutant

Details for d5ja7b_

PDB Entry: 5ja7 (more details), 1.61 Å

PDB Description: human cathepsin k mutant c25s in complex with the allosteric effector nsc94914
PDB Compounds: (B:) cathepsin k

SCOPe Domain Sequences for d5ja7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja7b_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d5ja7b_:

Click to download the PDB-style file with coordinates for d5ja7b_.
(The format of our PDB-style files is described here.)

Timeline for d5ja7b_:

  • d5ja7b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30