SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ls9f_ (5ls9 F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (37 species)
    not a true protein
  7. 1990539Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries)
  8. 2283427Domain d5ls9f_: 5ls9 F: [326728]
    automated match to d2x17m_
    complexed with mg

Details for d5ls9f_

PDB Entry: 5ls9 (more details), 2.93 Å

PDB Description: humanized archaeal ferritin
PDB Compounds: (F:) Ferritin, putative

SCOPe Domain Sequences for d5ls9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ls9f_ a.25.1.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrqftp

SCOPe Domain Coordinates for d5ls9f_:

Click to download the PDB-style file with coordinates for d5ls9f_.
(The format of our PDB-style files is described here.)

Timeline for d5ls9f_:

  • d5ls9f_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30