SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fwre_ (5fwr E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033932Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2033937Family b.2.3.2: Pilus subunits [49405] (10 protein domains)
  6. 2034079Protein automated matches [190569] (10 species)
    not a true protein
  7. 2034098Species Escherichia coli [TaxId:83333] [269237] (11 PDB entries)
  8. 2283421Domain d5fwre_: 5fwr E: [326722]
    automated match to d4csta_
    complexed with 3x8; mutant

Details for d5fwre_

PDB Entry: 5fwr (more details), 2.13 Å

PDB Description: breaking down the wall: mutation of the tyrosine gate of the universal escherichia coli fimbrial adhesin fimh
PDB Compounds: (E:) type 1 fimbiral adhesin fimh

SCOPe Domain Sequences for d5fwre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fwre_ b.2.3.2 (E:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5fwre_:

Click to download the PDB-style file with coordinates for d5fwre_.
(The format of our PDB-style files is described here.)

Timeline for d5fwre_:

  • d5fwre_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30