SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jh3a_ (5jh3 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154605Protein (Pro)cathepsin K [54028] (3 species)
  7. 2154606Species Human (Homo sapiens) [TaxId:9606] [54029] (51 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. 2283420Domain d5jh3a_: 5jh3 A: [326721]
    automated match to d2r6na_
    complexed with act, cl, so4; mutant

Details for d5jh3a_

PDB Entry: 5jh3 (more details), 1.75 Å

PDB Description: human cathepsin k mutant c25s
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d5jh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jh3a_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
pdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqnlvdcvsend
gcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekal
kravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiik
nswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d5jh3a_:

Click to download the PDB-style file with coordinates for d5jh3a_.
(The format of our PDB-style files is described here.)

Timeline for d5jh3a_:

  • d5jh3a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30