Lineage for d5jh3a_ (5jh3 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154605Protein (Pro)cathepsin K [54028] (3 species)
  7. 2154606Species Human (Homo sapiens) [TaxId:9606] [54029] (51 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. 2283420Domain d5jh3a_: 5jh3 A: [326721]
    automated match to d2r6na_
    complexed with act, cl, so4; mutant

Details for d5jh3a_

PDB Entry: 5jh3 (more details), 1.75 Å

PDB Description: human cathepsin k mutant c25s
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d5jh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jh3a_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
pdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqnlvdcvsend
gcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekal
kravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiik
nswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d5jh3a_:

Click to download the PDB-style file with coordinates for d5jh3a_.
(The format of our PDB-style files is described here.)

Timeline for d5jh3a_:

  • d5jh3a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30