SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gy7b_ (5gy7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2283377Species Escherichia coli [TaxId:83333] [326678] (1 PDB entry)
  8. 2283417Domain d5gy7b_: 5gy7 B: [326718]
    automated match to d1kvqa_
    complexed with gol, nad, no3, udp; mutant

Details for d5gy7b_

PDB Entry: 5gy7 (more details), 1.43 Å

PDB Description: x-ray structure of h243i mutant of udp-galactose 4-epimerase from e.coli:evidence for existence of open and closed active site during catalysis.
PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d5gy7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gy7b_ c.2.1.2 (B:) automated matches {Escherichia coli [TaxId: 83333]}
mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
dgivvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd

SCOPe Domain Coordinates for d5gy7b_:

Click to download the PDB-style file with coordinates for d5gy7b_.
(The format of our PDB-style files is described here.)

Timeline for d5gy7b_:

  • d5gy7b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30