SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5llta1 (5llt A:3-205)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (46 species)
    not a true protein
  7. 2106167Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)
  8. 2283410Domain d5llta1: 5llt A:3-205 [326711]
    Other proteins in same PDB: d5llta2, d5lltb2
    automated match to d4ymia_
    complexed with dnd, edo, peg

Details for d5llta1

PDB Entry: 5llt (more details), 2.2 Å

PDB Description: plasmodium falciparum nicotinic acid mononucleotide adenylyltransferase complexed with naad
PDB Compounds: (A:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d5llta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llta1 c.26.1.0 (A:3-205) automated matches {Plasmodium falciparum [TaxId: 36329]}
hkniciyggsfdpityahemvldkisnlnwiheiwvvicrcrndksltefhhrhnmftii
innsskiikskiflkdleshsemtptydllktqkelhpnytfyfglgsdlicdifswdeg
eklvlenafiiierghfkidesilkkfpkyylinipklsfinfisssearkfltkendin
dikkyihpltidyiikynlydfn

SCOPe Domain Coordinates for d5llta1:

Click to download the PDB-style file with coordinates for d5llta1.
(The format of our PDB-style files is described here.)

Timeline for d5llta1:

  • d5llta1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5llta2