SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ktlb1 (5ktl B:2-294)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (73 species)
    not a true protein
  7. 2283400Species Anabaena variabilis [TaxId:240292] [326701] (1 PDB entry)
  8. 2283401Domain d5ktlb1: 5ktl B:2-294 [326702]
    Other proteins in same PDB: d5ktla2, d5ktlb2
    automated match to d4icna_
    complexed with mn

Details for d5ktlb1

PDB Entry: 5ktl (more details), 1.92 Å

PDB Description: dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis.
PDB Compounds: (B:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d5ktlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ktlb1 c.1.10.0 (B:2-294) automated matches {Anabaena variabilis [TaxId: 240292]}
gdfgtvltamitpfkadgsvnyavaaelaahlvdngtdtlvvcgttgesptlswdeeynl
fvevlqtvagkakviagcgsnstkeaiaatqkaakigvhgtlqvvpyynkppqaglyqhf
qaiaqacpdlplllynvpgrtgqnlspetvvrlaeidniigvxeasgnldqageirrstp
kefqiyagddsltlpllaigakgvvsvashlvgnqlqqmiqafnsgqvtvasdihlrllp
lfkalfittnpipikqalklqgwevgstrpplsdadaevsqkleavmkhlnli

SCOPe Domain Coordinates for d5ktlb1:

Click to download the PDB-style file with coordinates for d5ktlb1.
(The format of our PDB-style files is described here.)

Timeline for d5ktlb1:

  • d5ktlb1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5ktlb2