Lineage for d5k9qa_ (5k9q A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775721Domain d5k9qa_: 5k9q A: [326699]
    Other proteins in same PDB: d5k9qb_, d5k9qd_, d5k9qf_, d5k9qg_, d5k9qh_, d5k9qi1, d5k9qi2, d5k9qj_, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qn_, d5k9qp_, d5k9qr_, d5k9qs_, d5k9qt1, d5k9qt2, d5k9qu_, d5k9qv1, d5k9qv2, d5k9qx_, d5k9qy1, d5k9qy2
    automated match to d2ypgc_
    complexed with nag

Details for d5k9qa_

PDB Entry: 5k9q (more details), 2.5 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.a.26 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d5k9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9qa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst
nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins
ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqntlklatgmrnvpeka

SCOPe Domain Coordinates for d5k9qa_:

Click to download the PDB-style file with coordinates for d5k9qa_.
(The format of our PDB-style files is described here.)

Timeline for d5k9qa_: