Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
Domain d5k9qa_: 5k9q A: [326699] Other proteins in same PDB: d5k9qb_, d5k9qd_, d5k9qf_, d5k9qg_, d5k9qh_, d5k9qi1, d5k9qi2, d5k9qj_, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qn_, d5k9qp_, d5k9qr_, d5k9qs_, d5k9qt1, d5k9qt2, d5k9qu_, d5k9qv1, d5k9qv2, d5k9qx_, d5k9qy1, d5k9qy2 automated match to d2ypgc_ complexed with nag |
PDB Entry: 5k9q (more details), 2.5 Å
SCOPe Domain Sequences for d5k9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k9qa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk yvkqntlklatgmrnvpeka
Timeline for d5k9qa_:
View in 3D Domains from other chains: (mouse over for more information) d5k9qb_, d5k9qc_, d5k9qd_, d5k9qe_, d5k9qf_, d5k9qg_, d5k9qh_, d5k9qi1, d5k9qi2, d5k9qj_, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qm_, d5k9qn_, d5k9qo_, d5k9qp_, d5k9qq_, d5k9qr_, d5k9qs_, d5k9qt1, d5k9qt2, d5k9qu_, d5k9qv1, d5k9qv2, d5k9qx_, d5k9qy1, d5k9qy2 |